Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27745
Artikelname: Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27745
Hersteller Artikelnummer: RPC27745
Alternativnummer: BIM-RPC27745-20UG,BIM-RPC27745-100UG,BIM-RPC27745-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rickettsia typhi (strain ATCC VR-144 / Wilmington). Target Name: RT0041. Accession Number: Q68XW4. Expression Region: 70~147aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: LALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPR
Target-Kategorie: RT0041