Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27745
Article Name: Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27745
Supplier Catalog Number: RPC27745
Alternative Catalog Number: BIM-RPC27745-20UG,BIM-RPC27745-100UG,BIM-RPC27745-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rickettsia typhi (strain ATCC VR-144 / Wilmington). Target Name: RT0041. Accession Number: Q68XW4. Expression Region: 70~147aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 15.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPR
Target: RT0041