Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A), Unconjugated, E. coli

Artikelnummer: BIM-RPC27756
Artikelname: Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A), Unconjugated, E. coli
Artikelnummer: BIM-RPC27756
Hersteller Artikelnummer: RPC27756
Alternativnummer: BIM-RPC27756-20UG,BIM-RPC27756-100UG,BIM-RPC27756-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Guinea pig
Konjugation: Unconjugated
Alternative Synonym: Interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19, IL-23p19
Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Guinea pig (Cavia porcellus). Target Name: IL23A. Target Synonyms: Interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19, IL-23p19. Accession Number: Q6LA37. Expression Region: 20~189aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 26.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
Target-Kategorie: IL23A