Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A), Unconjugated, E. coli

Catalog Number: BIM-RPC27756
Article Name: Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27756
Supplier Catalog Number: RPC27756
Alternative Catalog Number: BIM-RPC27756-20UG,BIM-RPC27756-100UG,BIM-RPC27756-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Guinea pig
Conjugation: Unconjugated
Alternative Names: Interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19, IL-23p19
Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Guinea pig (Cavia porcellus). Target Name: IL23A. Target Synonyms: Interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19, IL-23p19. Accession Number: Q6LA37. Expression Region: 20~189aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
Target: IL23A