Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS), Unconjugated, E. coli

Artikelnummer: BIM-RPC28736
Artikelname: Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS), Unconjugated, E. coli
Artikelnummer: BIM-RPC28736
Hersteller Artikelnummer: RPC28736
Alternativnummer: BIM-RPC28736-20UG,BIM-RPC28736-100UG,BIM-RPC28736-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Immunoglubulin-degrading enzyme
Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes. Target Name: ideS. Target Synonyms: Immunoglubulin-degrading enzyme. Accession Number: F8V4V0. Expression Region: 30~341aa. Tag Info: C-Terminal 11Xhis-Tagged. Theoretical MW: 36.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36.9kDa
Tag: C-Terminal 11Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYV
Target-Kategorie: ideS