Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS), Unconjugated, E. coli

Catalog Number: BIM-RPC28736
Article Name: Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28736
Supplier Catalog Number: RPC28736
Alternative Catalog Number: BIM-RPC28736-20UG,BIM-RPC28736-100UG,BIM-RPC28736-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Immunoglubulin-degrading enzyme
Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes. Target Name: ideS. Target Synonyms: Immunoglubulin-degrading enzyme. Accession Number: F8V4V0. Expression Region: 30~341aa. Tag Info: C-Terminal 11Xhis-Tagged. Theoretical MW: 36.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.9kDa
Tag: C-Terminal 11Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYV
Target: ideS