Recombinant Human Histone deacetylase 1 (HDAC1), Unconjugated, E. coli

Artikelnummer: BIM-RPC28774
Artikelname: Recombinant Human Histone deacetylase 1 (HDAC1), Unconjugated, E. coli
Artikelnummer: BIM-RPC28774
Hersteller Artikelnummer: RPC28774
Alternativnummer: BIM-RPC28774-20UG,BIM-RPC28774-100UG,BIM-RPC28774-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DKFZp686H12203, GON 10, HD1, HDAC 1, HDAC1, HDAC1_HUMAN, Histone deacetylase 1, Reduced potassium dependency yeast homolog like 1, RPD3, RPD3L1
Recombinant Human Histone deacetylase 1 (HDAC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HDAC1. Target Synonyms: DKFZp686H12203, GON 10, HD1, HDAC 1, HDAC1, HDAC1_HUMAN, Histone deacetylase 1, Reduced potassium dependency yeast homolog like 1, RPD3, RPD3L1. Accession Number: Q13547. Expression Region: 1~482aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 71.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 71.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPS
Target-Kategorie: HDAC1