Recombinant Human Histone deacetylase 1 (HDAC1), Unconjugated, E. coli

Catalog Number: BIM-RPC28774
Article Name: Recombinant Human Histone deacetylase 1 (HDAC1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28774
Supplier Catalog Number: RPC28774
Alternative Catalog Number: BIM-RPC28774-20UG,BIM-RPC28774-100UG,BIM-RPC28774-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DKFZp686H12203, GON 10, HD1, HDAC 1, HDAC1, HDAC1_HUMAN, Histone deacetylase 1, Reduced potassium dependency yeast homolog like 1, RPD3, RPD3L1
Recombinant Human Histone deacetylase 1 (HDAC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HDAC1. Target Synonyms: DKFZp686H12203, GON 10, HD1, HDAC 1, HDAC1, HDAC1_HUMAN, Histone deacetylase 1, Reduced potassium dependency yeast homolog like 1, RPD3, RPD3L1. Accession Number: Q13547. Expression Region: 1~482aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 71.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 71.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPS
Target: HDAC1