Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Propionate kinase (tdcD), Unconjugated, E. coli
Artikelnummer:
BIM-RPC31112
| Artikelname: |
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Propionate kinase (tdcD), Unconjugated, E. coli |
| Artikelnummer: |
BIM-RPC31112 |
| Hersteller Artikelnummer: |
RPC31112 |
| Alternativnummer: |
BIM-RPC31112-20UG,BIM-RPC31112-100UG,BIM-RPC31112-1MG |
| Hersteller: |
Biomatik Corporation |
| Wirt: |
E. coli |
| Kategorie: |
Proteine/Peptide |
| Konjugation: |
Unconjugated |
| Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Propionate kinase (tdcD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081). Target Name: Propionate kinase (tdcD) . Accession Number: A1JIM9, tdcD. Expression Region: 1-406aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 49.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures. |
| Molekulargewicht: |
49.0kDa |
| Tag: |
N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged |
| Reinheit: |
>85% by SDS-PAGE |
| Sequenz: |
MTLNPTVLVINCGSSSIKFSVLTADNCEAVISGIADGIGTEKPFLRIDRVTQFQLAKWNYSDALAAIADELDKRGLSKSISLIGHRIAHGGEIFSESVLIDDRVVEEIKKVSPLAPLHNYANLHGVGAARQLFPGIKQVAVFDTGFHQTLKPEAYLYALPYRYFREQGVRRYGFHGTSYRYVVGEAASFLGFDGSDCGLIIAHLGNGASLCAVQDGKSVDTSMGMTPLEGLIMGTRSGDVDYGALAYLARQTGQS |
| Target-Kategorie: |
Propionate kinase (tdcD) |
