Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Propionate kinase (tdcD), Unconjugated, E. coli

Catalog Number: BIM-RPC31112
Article Name: Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Propionate kinase (tdcD), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31112
Supplier Catalog Number: RPC31112
Alternative Catalog Number: BIM-RPC31112-20UG,BIM-RPC31112-100UG,BIM-RPC31112-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Propionate kinase (tdcD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081). Target Name: Propionate kinase (tdcD) . Accession Number: A1JIM9, tdcD. Expression Region: 1-406aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 49.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.0kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: MTLNPTVLVINCGSSSIKFSVLTADNCEAVISGIADGIGTEKPFLRIDRVTQFQLAKWNYSDALAAIADELDKRGLSKSISLIGHRIAHGGEIFSESVLIDDRVVEEIKKVSPLAPLHNYANLHGVGAARQLFPGIKQVAVFDTGFHQTLKPEAYLYALPYRYFREQGVRRYGFHGTSYRYVVGEAASFLGFDGSDCGLIIAHLGNGASLCAVQDGKSVDTSMGMTPLEGLIMGTRSGDVDYGALAYLARQTGQS
Target: Propionate kinase (tdcD)