Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1), Unconjugated, Virus

Artikelnummer: BIM-RPC31163
Artikelname: Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1), Unconjugated, Virus
Artikelnummer: BIM-RPC31163
Hersteller Artikelnummer: RPC31163
Alternativnummer: BIM-RPC31163-20UG,BIM-RPC31163-100UG,BIM-RPC31163-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: TN-C
Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Troponin C, slow skeletal and cardiac muscles (TNNC1) . Accession Number: P63316, TNNC1. Expression Region: 1-161aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 19.5kda. Target Synonyms: TN-C Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.5kDa
Tag: C-Terminal 6xHis-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Target-Kategorie: Troponin C, slow skeletal and cardiac muscles (TNNC1)