Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1), Unconjugated, Virus

Catalog Number: BIM-RPC31163
Article Name: Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1), Unconjugated, Virus
Biozol Catalog Number: BIM-RPC31163
Supplier Catalog Number: RPC31163
Alternative Catalog Number: BIM-RPC31163-20UG,BIM-RPC31163-100UG,BIM-RPC31163-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: TN-C
Recombinant Human Troponin C, slow skeletal and cardiac muscles (TNNC1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Troponin C, slow skeletal and cardiac muscles (TNNC1) . Accession Number: P63316, TNNC1. Expression Region: 1-161aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 19.5kda. Target Synonyms: TN-C Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.5kDa
Tag: C-Terminal 6xHis-Tagged
Purity: >85% by SDS-PAGE
Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Target: Troponin C, slow skeletal and cardiac muscles (TNNC1)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL