Recombinant Human Tapasin (TAPBP), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC31245
Artikelname: Recombinant Human Tapasin (TAPBP), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC31245
Hersteller Artikelnummer: RPC31245
Alternativnummer: BIM-RPC31245-20UG,BIM-RPC31245-100UG,BIM-RPC31245-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: TPN, TPSN, NGS-17, TAP-associated protein, TAP-binding protein
Recombinant Human Tapasin (TAPBP), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Tapasin (TAPBP) . Accession Number: O15533, TAPBP. Expression Region: 21-414aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 49.4kda. Target Synonyms: TPN, TPSN, NGS-17, TAP-associated protein, TAP-binding protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.4kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: GPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHL
Target-Kategorie: Tapasin (TAPBP)