Recombinant Human Tapasin (TAPBP), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31245
Article Name: Recombinant Human Tapasin (TAPBP), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31245
Supplier Catalog Number: RPC31245
Alternative Catalog Number: BIM-RPC31245-20UG,BIM-RPC31245-100UG,BIM-RPC31245-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: TPN, TPSN, NGS-17, TAP-associated protein, TAP-binding protein
Recombinant Human Tapasin (TAPBP), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Tapasin (TAPBP) . Accession Number: O15533, TAPBP. Expression Region: 21-414aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 49.4kda. Target Synonyms: TPN, TPSN, NGS-17, TAP-associated protein, TAP-binding protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.4kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: GPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHL
Target: Tapasin (TAPBP)