Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC31283
Artikelname: Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC31283
Hersteller Artikelnummer: RPC31283
Alternativnummer: BIM-RPC31283-20UG,BIM-RPC31283-100UG,BIM-RPC31283-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: ADAM-TS 14, ADAM-TS14, ADAMTS-14
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14) . Accession Number: Q8WXS8, ADAMTS14. Expression Region: 253-555aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 40.2kda. Target Synonyms: ADAM-TS 14, ADAM-TS14, ADAMTS-14 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 40.2kDa
Tag: N-Terminal 6xHis-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWC
Target-Kategorie: A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14)