Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31283
Article Name: Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31283
Supplier Catalog Number: RPC31283
Alternative Catalog Number: BIM-RPC31283-20UG,BIM-RPC31283-100UG,BIM-RPC31283-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ADAM-TS 14, ADAM-TS14, ADAMTS-14
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14) . Accession Number: Q8WXS8, ADAMTS14. Expression Region: 253-555aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 40.2kda. Target Synonyms: ADAM-TS 14, ADAM-TS14, ADAMTS-14 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 40.2kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWC
Target: A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAMTS14)