Recombinant Human Methyltransferase-like protein 25 (METTL25), Unconjugated, E. coli

Artikelnummer: BIM-RPC31284
Artikelname: Recombinant Human Methyltransferase-like protein 25 (METTL25), Unconjugated, E. coli
Artikelnummer: BIM-RPC31284
Hersteller Artikelnummer: RPC31284
Alternativnummer: BIM-RPC31284-20UG,BIM-RPC31284-100UG,BIM-RPC31284-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Recombinant Human Methyltransferase-like protein 25 (METTL25) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Methyltransferase-like protein 25 (METTL25) . Accession Number: Q8N6Q8, METTL25. Expression Region: 1-603aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 75.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 75.7kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLVEAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNK
Target-Kategorie: Methyltransferase-like protein 25 (METTL25)