Recombinant Human Methyltransferase-like protein 25 (METTL25), Unconjugated, E. coli

Catalog Number: BIM-RPC31284
Article Name: Recombinant Human Methyltransferase-like protein 25 (METTL25), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31284
Supplier Catalog Number: RPC31284
Alternative Catalog Number: BIM-RPC31284-20UG,BIM-RPC31284-100UG,BIM-RPC31284-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Recombinant Human Methyltransferase-like protein 25 (METTL25) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Methyltransferase-like protein 25 (METTL25) . Accession Number: Q8N6Q8, METTL25. Expression Region: 1-603aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 75.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 75.7kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLVEAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNK
Target: Methyltransferase-like protein 25 (METTL25)