Recombinant Human Fibroblast growth factor 3 (FGF3), Unconjugated, E. coli

Artikelnummer: BIM-RPC31315
Artikelname: Recombinant Human Fibroblast growth factor 3 (FGF3), Unconjugated, E. coli
Artikelnummer: BIM-RPC31315
Hersteller Artikelnummer: RPC31315
Alternativnummer: BIM-RPC31315-20UG,BIM-RPC31315-100UG,BIM-RPC31315-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: FGF-3, Heparin-binding growth factor 3, HBGF-3, Proto-oncogene Int-2
Recombinant Human Fibroblast growth factor 3 (FGF3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Fibroblast growth factor 3 (FGF3) . Accession Number: P11487, FGF3. Expression Region: 18-239aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.4kda. Target Synonyms: FGF-3, Heparin-binding growth factor 3, HBGF-3, Proto-oncogene Int-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.4kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >85% by SDS-PAGE
Sequenz: AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Target-Kategorie: Fibroblast growth factor 3 (FGF3)