Recombinant Human Fibroblast growth factor 3 (FGF3), Unconjugated, E. coli

Catalog Number: BIM-RPC31315
Article Name: Recombinant Human Fibroblast growth factor 3 (FGF3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31315
Supplier Catalog Number: RPC31315
Alternative Catalog Number: BIM-RPC31315-20UG,BIM-RPC31315-100UG,BIM-RPC31315-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: FGF-3, Heparin-binding growth factor 3, HBGF-3, Proto-oncogene Int-2
Recombinant Human Fibroblast growth factor 3 (FGF3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Fibroblast growth factor 3 (FGF3) . Accession Number: P11487, FGF3. Expression Region: 18-239aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 32.4kda. Target Synonyms: FGF-3, Heparin-binding growth factor 3, HBGF-3, Proto-oncogene Int-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.4kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Target: Fibroblast growth factor 3 (FGF3)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL