Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated, Unconjugated, Mammal

Artikelnummer: BIM-RPC31347
Artikelname: Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated, Unconjugated, Mammal
Artikelnummer: BIM-RPC31347
Hersteller Artikelnummer: RPC31347
Alternativnummer: BIM-RPC31347-20UG,BIM-RPC31347-100UG,BIM-RPC31347-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: CP, VP1
Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Lordsdale virus (strain GII/Human/United Kingdom/Lordsdale/1993) (Human enteric calicivirus) (Hu/NV/LD/1993/UK). Target Name: Lordsdale virus Capsid protein (ORF2) , Biotinylated. Accession Number: P54635, ORF2. Expression Region: 1-539aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-avi-tagged. Theoretical MW: 64.3kda. Target Synonyms: CP, VP1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 64.3kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-avi-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGGFEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPDVRNNFYHYNQANDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPPTVESRTKPFTVPVLTVEEMSNSRFPIPLEKLYTGPSS
Target-Kategorie: Lordsdale virus Capsid protein (ORF2) , Biotinylated



* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL