Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated, Unconjugated, Mammal

Catalog Number: BIM-RPC31347
Article Name: Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC31347
Supplier Catalog Number: RPC31347
Alternative Catalog Number: BIM-RPC31347-20UG,BIM-RPC31347-100UG,BIM-RPC31347-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: CP, VP1
Recombinant Lordsdale virus Capsid protein (ORF2), Biotinylated is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Lordsdale virus (strain GII/Human/United Kingdom/Lordsdale/1993) (Human enteric calicivirus) (Hu/NV/LD/1993/UK). Target Name: Lordsdale virus Capsid protein (ORF2) , Biotinylated. Accession Number: P54635, ORF2. Expression Region: 1-539aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-avi-tagged. Theoretical MW: 64.3kda. Target Synonyms: CP, VP1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 64.3kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-avi-Tagged
Purity: >90% by SDS-PAGE
Sequence: MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGGFEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPDVRNNFYHYNQANDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPPTVESRTKPFTVPVLTVEEMSNSRFPIPLEKLYTGPSS
Target: Lordsdale virus Capsid protein (ORF2) , Biotinylated