Recombinant Human Anoctamin-1 (ANO1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC31354
Artikelname: Recombinant Human Anoctamin-1 (ANO1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC31354
Hersteller Artikelnummer: RPC31354
Alternativnummer: BIM-RPC31354-20UG,BIM-RPC31354-100UG,BIM-RPC31354-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2
Recombinant Human Anoctamin-1 (ANO1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Anoctamin-1 (ANO1) . Accession Number: Q5XXA6, ANO1. Expression Region: 806-892aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.6kda. Target Synonyms: Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.6kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Reinheit: >90% by SDS-PAGE
Sequenz: SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA
Target-Kategorie: Anoctamin-1 (ANO1)