Recombinant Human Anoctamin-1 (ANO1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31354
Article Name: Recombinant Human Anoctamin-1 (ANO1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31354
Supplier Catalog Number: RPC31354
Alternative Catalog Number: BIM-RPC31354-20UG,BIM-RPC31354-100UG,BIM-RPC31354-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2
Recombinant Human Anoctamin-1 (ANO1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Anoctamin-1 (ANO1) . Accession Number: Q5XXA6, ANO1. Expression Region: 806-892aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.6kda. Target Synonyms: Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.6kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA
Target: Anoctamin-1 (ANO1)