Mouse Srpx2 protein

Artikelnummer: BYT-ORB10299
Artikelname: Mouse Srpx2 protein
Artikelnummer: BYT-ORB10299
Hersteller Artikelnummer: orb10299
Alternativnummer: BYT-ORB10299-20,BYT-ORB10299-100,BYT-ORB10299-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Srpx2Sushi repeat-containing protein SRPX2
This Mouse Srpx2 protein spans the amino acid sequence from region 26-468aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 70.5 kDa
UniProt: Q8R054
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTC
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 26-468aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Srpx2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Srpx2.