Mouse Srpx2 protein
Catalog Number:
BYT-ORB10299
- Images (3)
| Article Name: | Mouse Srpx2 protein |
| Biozol Catalog Number: | BYT-ORB10299 |
| Supplier Catalog Number: | orb10299 |
| Alternative Catalog Number: | BYT-ORB10299-20,BYT-ORB10299-100,BYT-ORB10299-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Srpx2Sushi repeat-containing protein SRPX2 |
| This Mouse Srpx2 protein spans the amino acid sequence from region 26-468aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 70.5 kDa |
| UniProt: | Q8R054 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTC |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 26-468aaSequence Info: Full Length of Mature Protein |



