esxC Protein

Artikelnummer: BYT-ORB1477069
Artikelname: esxC Protein
Artikelnummer: BYT-ORB1477069
Hersteller Artikelnummer: orb1477069
Alternativnummer: BYT-ORB1477069-1,BYT-ORB1477069-100,BYT-ORB1477069-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Ess extracellular protein C)
This esxC Protein spans the amino acid sequence from region 1-130aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 22.4 kDa
UniProt: P0C051
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus (strain Newman)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAKDVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEKASEYFNKAMN
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain Newman). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.