esxC Protein

Catalog Number: BYT-ORB1477069
Article Name: esxC Protein
Biozol Catalog Number: BYT-ORB1477069
Supplier Catalog Number: orb1477069
Alternative Catalog Number: BYT-ORB1477069-1,BYT-ORB1477069-100,BYT-ORB1477069-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Ess extracellular protein C)
This esxC Protein spans the amino acid sequence from region 1-130aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.4 kDa
UniProt: P0C051
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus (strain Newman)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAKDVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEKASEYFNKAMN
Application Notes: Biological Origin: Staphylococcus aureus (strain Newman). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.