OSM Protein

Artikelnummer: BYT-ORB1477195
Artikelname: OSM Protein
Artikelnummer: BYT-ORB1477195
Hersteller Artikelnummer: orb1477195
Alternativnummer: BYT-ORB1477195-1,BYT-ORB1477195-100,BYT-ORB1477195-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.9 kDa
UniProt: F7GF43
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Macaca mulatta (Rhesus macaque)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR
Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.