OSM Protein

Catalog Number: BYT-ORB1477195
Article Name: OSM Protein
Biozol Catalog Number: BYT-ORB1477195
Supplier Catalog Number: orb1477195
Alternative Catalog Number: BYT-ORB1477195-1,BYT-ORB1477195-100,BYT-ORB1477195-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This OSM Protein spans the amino acid sequence from region 22-252aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.9 kDa
UniProt: F7GF43
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Macaca mulatta (Rhesus macaque)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR
Application Notes: Biological Origin: Macaca mulatta (Rhesus macaque)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.