Sheep IL12B protein

Artikelnummer: BYT-ORB244299
Artikelname: Sheep IL12B protein
Artikelnummer: BYT-ORB244299
Hersteller Artikelnummer: orb244299
Alternativnummer: BYT-ORB244299-20,BYT-ORB244299-100,BYT-ORB244299-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL12B
This Sheep IL12B protein spans the amino acid sequence from region 23-327aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.5 kDa
UniProt: P68220
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ovis aries (Sheep)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQ
Anwendungsbeschreibung: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of His-tag and expression region is 23-327aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.