Sheep IL12B protein

Catalog Number: BYT-ORB244299
Article Name: Sheep IL12B protein
Biozol Catalog Number: BYT-ORB244299
Supplier Catalog Number: orb244299
Alternative Catalog Number: BYT-ORB244299-20,BYT-ORB244299-100,BYT-ORB244299-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: IL12B
This Sheep IL12B protein spans the amino acid sequence from region 23-327aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.5 kDa
UniProt: P68220
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Ovis aries (Sheep)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQ
Application Notes: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of His-tag and expression region is 23-327aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.