Pig IL33 protein

Artikelnummer: BYT-ORB244304
Artikelname: Pig IL33 protein
Artikelnummer: BYT-ORB244304
Hersteller Artikelnummer: orb244304
Alternativnummer: BYT-ORB244304-20,BYT-ORB244304-100,BYT-ORB244304-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL33
This Pig IL33 protein spans the amino acid sequence from region 123-276aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.6 kDa
UniProt: M5B263
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sus scrofa (Pig)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM
Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: Expression region is 129-282aa and GST-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.