Pig IL33 protein

Catalog Number: BYT-ORB244304
Article Name: Pig IL33 protein
Biozol Catalog Number: BYT-ORB244304
Supplier Catalog Number: orb244304
Alternative Catalog Number: BYT-ORB244304-20,BYT-ORB244304-100,BYT-ORB244304-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: IL33
This Pig IL33 protein spans the amino acid sequence from region 123-276aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.6 kDa
UniProt: M5B263
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: Expression region is 129-282aa and GST-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.