Human E2 protein
Artikelnummer:
BYT-ORB246114
- Bilder (3)
| Artikelname: | Human E2 protein |
| Artikelnummer: | BYT-ORB246114 |
| Hersteller Artikelnummer: | orb246114 |
| Alternativnummer: | BYT-ORB246114-20,BYT-ORB246114-100,BYT-ORB246114-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | E2 |
| This Human E2 protein spans the amino acid sequence from region 1-365aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 43.3 kDa |
| UniProt: | P06790 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Human papillomavirus type 18 |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLA |
| Anwendungsbeschreibung: | Biological Origin: Human papillomavirus type 18. Application Notes: This is His-tag protein |



