Human E2 protein

Catalog Number: BYT-ORB246114
Article Name: Human E2 protein
Biozol Catalog Number: BYT-ORB246114
Supplier Catalog Number: orb246114
Alternative Catalog Number: BYT-ORB246114-20,BYT-ORB246114-100,BYT-ORB246114-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: E2
This Human E2 protein spans the amino acid sequence from region 1-365aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.3 kDa
UniProt: P06790
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human papillomavirus type 18
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLA
Application Notes: Biological Origin: Human papillomavirus type 18. Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Human papillomavirus type 18E2.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Human papillomavirus type 18E2.