Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs

Artikelnummer: BYT-ORB2658136
Artikelname: Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs
Artikelnummer: BYT-ORB2658136
Hersteller Artikelnummer: orb2658136
Alternativnummer: BYT-ORB2658136-1,BYT-ORB2658136-100,BYT-ORB2658136-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CXC-R6,CXCR-6
This Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs spans the amino acid sequence from region 1-342aa. Purity: The purity information is not available for VLPs proteins.
Molekulargewicht: 40.8 kDa
UniProt: O00574
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Homo sapiens (Human)
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 90% as determined by SEC-HPLC