Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs

Catalog Number: BYT-ORB2658136
Article Name: Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs
Biozol Catalog Number: BYT-ORB2658136
Supplier Catalog Number: orb2658136
Alternative Catalog Number: BYT-ORB2658136-1,BYT-ORB2658136-100,BYT-ORB2658136-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CXC-R6,CXCR-6
This Recombinant Human C-X-C chemokine receptor type 6 (CXCR6)-VLPs spans the amino acid sequence from region 1-342aa. Purity: The purity information is not available for VLPs proteins.
Molecular Weight: 40.8 kDa
UniProt: O00574
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Source: Homo sapiens (Human)
Purity: The purity information is not available for VLPs proteins.
Form: Lyophilized powder
Sequence: MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 90% as determined by SEC-HPLC