MYEF2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324427
- Bilder (5)
| Artikelname: | MYEF2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB324427 |
| Hersteller Artikelnummer: | orb324427 |
| Alternativnummer: | BYT-ORB324427-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human MYEF2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti MEF-2 antibody, anti MST156 antibody, anti MSTP156 antibody, anti HsT18564 antibody |
| Rabbit polyclonal antibody to MYEF2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 64kDa |
| NCBI: | 057216 |
| UniProt: | Q9P2K5 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG |
| Target-Kategorie: | MYEF2 |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL. |
|
|
Human Lung |
|
|
Rabbit Anti-MYEF2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
|
WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
