MYEF2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324427
- Images (5)
| Article Name: | MYEF2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB324427 |
| Supplier Catalog Number: | orb324427 |
| Alternative Catalog Number: | BYT-ORB324427-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human MYEF2 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti MEF-2 antibody, anti MST156 antibody, anti MSTP156 antibody, anti HsT18564 antibody |
| Rabbit polyclonal antibody to MYEF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 64kDa |
| NCBI: | 057216 |
| UniProt: | Q9P2K5 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG |
| Target: | MYEF2 |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL. |
|
|
Human Lung |
|
|
Rabbit Anti-MYEF2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
|
WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
