SLC18A1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324613
| Artikelname: |
SLC18A1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324613 |
| Hersteller Artikelnummer: |
orb324613 |
| Alternativnummer: |
BYT-ORB324613-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CGAT antibody, anti VAT1 antibody, anti VMAT1 antibody |
| Rabbit polyclonal antibody to SLC18A1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
56 kDa |
| NCBI: |
003044 |
| UniProt: |
P54219 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
| Target-Kategorie: |
SLC18A1 |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. |
![]()
|
Brain, cortex. |
![]()
|
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL. |
![]()
|
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-SLC18A1 antibody (orb324613). |
![]()
|
WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. |
