SLC18A1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324613
| Article Name: |
SLC18A1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324613 |
| Supplier Catalog Number: |
orb324613 |
| Alternative Catalog Number: |
BYT-ORB324613-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti CGAT antibody, anti VAT1 antibody, anti VMAT1 antibody |
| Rabbit polyclonal antibody to SLC18A1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
56 kDa |
| NCBI: |
003044 |
| UniProt: |
P54219 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
| Target: |
SLC18A1 |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. |
![]()
|
Brain, cortex. |
![]()
|
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL. |
![]()
|
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-SLC18A1 antibody (orb324613). |
![]()
|
WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate. |
