Nkx2-3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324670
- Bilder (5)
| Artikelname: | Nkx2-3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB324670 |
| Hersteller Artikelnummer: | orb324670 |
| Alternativnummer: | BYT-ORB324670-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the c terminal region of mouse Nkx2-3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti Nkx-2.3 antibody, anti Nkx2.3 antibody, anti tinman antibody |
| Rabbit polyclonal antibody to Nkx2-3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 38 kDa |
| NCBI: | 032725 |
| UniProt: | P97334 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG |
| Target-Kategorie: | Nkx2-3 |
|
|
25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|
25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Only 39 kDa is known to contain immunogen. |
|
|
IHC Information: Paraffin embedded mouse lymphoid tissue (skeletal muscle) tissue, tested with an antibody dilution of 5 ug/mL. |
|
|
IHC Information: Paraffin embedded spleenlympho tissue, tested with an antibody dilution of 5 ug/mL. |
|
|
WB Suggested Anti-Nkx2-3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Uterus. |
Produktgarantie und fachkundiger Support
