Nkx2-3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324670
- Images (5)
| Article Name: | Nkx2-3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB324670 |
| Supplier Catalog Number: | orb324670 |
| Alternative Catalog Number: | BYT-ORB324670-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the c terminal region of mouse Nkx2-3 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti Nkx-2.3 antibody, anti Nkx2.3 antibody, anti tinman antibody |
| Rabbit polyclonal antibody to Nkx2-3 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 38 kDa |
| NCBI: | 032725 |
| UniProt: | P97334 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG |
| Target: | Nkx2-3 |
|
|
25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|
25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Only 39 kDa is known to contain immunogen. |
|
|
IHC Information: Paraffin embedded mouse lymphoid tissue (skeletal muscle) tissue, tested with an antibody dilution of 5 ug/mL. |
|
|
IHC Information: Paraffin embedded spleenlympho tissue, tested with an antibody dilution of 5 ug/mL. |
|
|
WB Suggested Anti-Nkx2-3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Uterus. |
Product Guarantee and Expert Support
