Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
Target-Kategorie:
AIFM1
AIFM1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb324833 with 1:200 dilution. Western blot was performed using orb324833 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: AIFM1 IP with orb324833 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
