PDCD8 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324833
Article Name: PDCD8 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324833
Supplier Catalog Number: orb324833
Alternative Catalog Number: BYT-ORB324833-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDCD8
Conjugation: Unconjugated
Alternative Names: anti AIF antibody, anti PDCD8 antibody, anti COXPD6 antibody
Rabbit polyclonal antibody to AIFM1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 36kDa
NCBI: 665812
UniProt: O95831
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
Target: AIFM1
AIFM1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb324833 with 1:200 dilution. Western blot was performed using orb324833 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: AIFM1 IP with orb324833 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human Kidney Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat.