CELF2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324847
- Bilder (6)
| Artikelname: | CELF2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB324847 |
| Hersteller Artikelnummer: | orb324847 |
| Alternativnummer: | BYT-ORB324847-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CELF2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti BRUNOL3 antibody, anti ETR-3 antibody, anti NAPOR antibody, anti ETR3 antibody, anti CUGBP2 antibody |
| Rabbit polyclonal antibody to CELF2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 55 kDa |
| NCBI: | 001313248 |
| UniProt: | O95319 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN |
| Target-Kategorie: | CELF2 |
|
|
Sample Tissue: Human U937 Whole Cell lysates, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat. |
Produktgarantie und fachkundiger Support
