CELF2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324847
- Images (6)
| Article Name: | CELF2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB324847 |
| Supplier Catalog Number: | orb324847 |
| Alternative Catalog Number: | BYT-ORB324847-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CELF2 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti BRUNOL3 antibody, anti ETR-3 antibody, anti NAPOR antibody, anti ETR3 antibody, anti CUGBP2 antibody |
| Rabbit polyclonal antibody to CELF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 55 kDa |
| NCBI: | 001313248 |
| UniProt: | O95319 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCN |
| Target: | CELF2 |
|
|
Sample Tissue: Human U937 Whole Cell lysates, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, CELF2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat. |
Product Guarantee and Expert Support
