SLC5A5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325092
| Artikelname: |
SLC5A5 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB325092 |
| Hersteller Artikelnummer: |
orb325092 |
| Alternativnummer: |
BYT-ORB325092-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A5 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti NIS antibody, anti TDH1 antibody |
| Rabbit polyclonal antibody to SLC5A5 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
69 kDa |
| NCBI: |
000444 |
| UniProt: |
Q92911 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR |
| Target-Kategorie: |
SLC5A5 |
![]()
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
![]()
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
![]()
|
Rabbit Anti-SLC5A5 Antibody, Catalog Number: orb325092, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data. |
![]()
|
WB Suggested Anti-SLC5A5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: COLO205 cell lysate. |
![]()
|
WB Suggested Anti-SLC5A5 antibody Titration: 1 ug/mL, Sample Type: Human liver. |
