SLC5A5 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325092
| Article Name: |
SLC5A5 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB325092 |
| Supplier Catalog Number: |
orb325092 |
| Alternative Catalog Number: |
BYT-ORB325092-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A5 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti NIS antibody, anti TDH1 antibody |
| Rabbit polyclonal antibody to SLC5A5 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
69 kDa |
| NCBI: |
000444 |
| UniProt: |
Q92911 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR |
| Target: |
SLC5A5 |
![]()
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
![]()
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
![]()
|
Rabbit Anti-SLC5A5 Antibody, Catalog Number: orb325092, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data. |
![]()
|
WB Suggested Anti-SLC5A5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: COLO205 cell lysate. |
![]()
|
WB Suggested Anti-SLC5A5 antibody Titration: 1 ug/mL, Sample Type: Human liver. |
